PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi06g02730.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family SRS
Protein Properties Length: 331aa    MW: 33717.9 Da    PI: 8.3953
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi06g02730.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702220.73.1e-681062663154
           DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaes 96 
                      sg+++CqdCGnqakkdC+ +RCRtCCksrgfdC thvkstWvpaa+rrerq ++aa+++ a +s +++ +k++r   +++++++s+t++s++++
  Vradi06g02730.1 106 SGGTTCQDCGNQAKKDCTNRRCRTCCKSRGFDCPTHVKSTWVPAARRRERQLMTAATAAVAGSSGSTSGTKKPRLI-ASQTTTTSHTSTSNTTP 198
                      7889*************************************************99999999999999999999986.88899999********* PP

           DUF702  97 kkeletss..........lPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                      +++++tss          lP +v+++avf+cvrv++v+dg++e+aYq++v+igGhvfkG+LydqG+e+
  Vradi06g02730.1 199 PRSFDTSSshqdagfkesLPGQVRAPAVFKCVRVTAVEDGQDEYAYQAVVKIGGHVFKGFLYDQGVEN 266
                      ******999********************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051424.2E-62108265IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016234.7E-27110152IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016241.7E-29217264IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0048364Biological Processroot development
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MEDSGAFADW AGTGSSTAAA AGGRAVPVDD LSLGFNAGPA APAAATGPTT GMWPRGGGIQ  60
FWQDQGPHQS HYMKKQQQQG LLDQSNTSSG NLVQTSGGLT ASGTSSGGTT CQDCGNQAKK  120
DCTNRRCRTC CKSRGFDCPT HVKSTWVPAA RRRERQLMTA ATAAVAGSSG STSGTKKPRL  180
IASQTTTTSH TSTSNTTPPR SFDTSSSHQD AGFKESLPGQ VRAPAVFKCV RVTAVEDGQD  240
EYAYQAVVKI GGHVFKGFLY DQGVENRDVY PNLSELHLGG GNGGSGSGGS GGVGRNGVSS  300
SSPMMDPSDV YAGSGGGLLG GSSAYGNPMN *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150360.0AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007141493.11e-160hypothetical protein PHAVU_008G200700g
SwissprotQ94CK91e-83LRP1_ARATH; Protein LATERAL ROOT PRIMORDIUM 1
TrEMBLV7B6F11e-160V7B6F1_PHAVU; Uncharacterized protein
STRINGGLYMA02G44860.21e-143(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65043351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.21e-68Lateral root primordium (LRP) protein-related